| Name
|
Amylin, Amide, Rat
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
|
| Sequence（Three letter abbreviations）
|
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}
|
| C-port
|
NH2
|
| Chemical bridge
|
Disulfide bridge: Cys2-Cys7
|
| Basic description
|
Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.
|
| Solubility
|
Can be dissolved in water directly
|
| The molecular weight
|
3920.500
|
| Chemical formula
|
C167H272N52O53S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Stadler M, et al. Increased plasma amylin in type 1 diabetic patients after kidney and pancreas transplantation: A sign of impaired beta-cell function? Diabetes Care. May 2006; 29(5): 1031-1038.
Kairamkonda V, et al. Amylin peptide levels are raised in infants of diabetic mothers. Arch. Dis. Child. Dec 2005; 90(12): 1279-1282.
Takenaka S., etc. Organic Solvent-Tolerant Elastase Efficiently Hydrolyzes Insoluble, Cross-Linked, Protein Fiber Of Eggshell Membranes. Biotechnol Lett. 2012 May;34(5):949-55.
Guerreiro LH., etc. Amylin induces hypoglycemia in mice. An Acad Bras Cienc. 2013 Mar;85(1):349-354.
Guerreiro LH., etc. Preparation and Characterization of PEGylated Amylin. AAPS PharmSciTech. 2013 Sep;14(3):1083-1097.
|
Amylin, Amide, Rat
