| Name
|
Calcitonin, Eel
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
|
| Sequence(Three letter abbreviations)
|
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2
|
| C-port
|
NH2
|
| Chemical bridge
|
Disulfide bridge: Cys1-Cys7
|
| Basic description
|
Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
|
| The molecular weight
|
3414.900
|
| Chemical formula
|
C146H241N43O47S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
Calcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Supowit SC, et al. Calcitonin gene-related peptide protects against hypertension-induced heart and kidney damage. Hypertension. Jan 2005; 45(1): 109-114.
Bowers MC, et al. Role of calcitonin gene-related peptide in hypertension-induced renal damage. Hypertension. Jul 2005; 46(1): 51-57.
Barbet J, et al. Prognostic impact of serum calcitonin and carcinoembryonic antigen doubling-times in patients with medullary thyroid carcinoma. J. Clin. Endocrinol. Metab. Nov 2005; 90(11): 6077-6084.
|