| Name
|
Calcitonin, Salmon
|
| Other Name
|
Thyrocalcitonin
|
| Sequence (Single letter abbreviations)
|
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
|
| Sequence(Three letter abbreviations)
|
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASN}{THR}{GLY}{SER}{GLY}{THR}{PRO}-NH2
|
| C-port
|
NH2
|
| Chemical bridge
|
Disulfide bridge: Cys1-Cys7
|
| Basic description
|
Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
3431.900
|
| Chemical formula
|
C145H240N44O48S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
Calcitonin is a 32 amino acid polypeptide, 8 of which are conserved across all species.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Schweitzer-Stenner R, et al. Salmon calcitonin and amyloid beta: two peptides with amyloidogenic capacity adopt different conformational manifolds in their unfolded states. Biochemistry. Mar 2006; 45(9): 2810-2819.
Sahin F, et al. Efficacy of salmon calcitonin in complex regional pain syndrome (type 1) in addition to physical therapy. Clin. Rheumatol. Mar 2006; 25(2): 143-148.
Ofluoglu D, et al. Early effect of nasal salmon calcitonin on the bone marker Crosslaps. Rheumatol. Int. Feb 2006; 26(4): 288-291.
|