| Name
|
Exendin (9-39)
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
|
| Sequence(Three letter abbreviations)
|
{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
|
| The molecular weight
|
3369.760
|
| Chemical formula
|
C149H234N40O47S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C.
|
| Annotation
|
Specific exendin receptor antagonist.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Green BD, et al. Chronic treatment with exendin(9-39)amide indicates a minor role for endogenous glucagon-like peptide-1 in metabolic abnormalities of obesity-related diabetes in ob/ob mice. J. Endocrinol. May 2005; 185(2): 307-317.
Ayachi SE, et al. Contraction induced by glicentin on smooth muscle cells from the human colon is abolished by exendin (9-39). Neurogastroenterol. Motil. Apr 2005; 17(2): 302-309.
|