| Name
|
Glucagon-Like Peptide (GLP) I (7-36), Amide, Human
|
| Other Name
|
GLP-1 (7-36), amide, humanGlucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1
|
| Sequence (Single letter abbreviations)
|
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
|
| Sequence（Three letter abbreviations）
|
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
|
| The molecular weight
|
3297.500
|
| Chemical formula
|
C149H226N40O45
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
|
Glucagon-Like Peptide (GLP) I (7-36), Amide, Human
