| Name
|
ll37 (Human)
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
|
| Sequence（Three letter abbreviations）
|
{LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS}{ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}{VAL}{GLN}{ARG}{ILE}{LYS} {ASP}{PHE}{LEU}{ARG}{ASN}{LEU}{VAL}{PRO}{ARG}{THR}{GLU}{SER}
|
| Basic description
|
The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.
|
| Solubility
|
Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer.
|
| The molecular weight
|
4493.280
|
| Chemical formula
|
C205H340N60O53
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the product at -20°C. Keep container tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Ouhara K, et al. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides, {beta}-defensins and LL37, produced by human epithelial cells. J. Antimicrob. Chemother. Jun 2005; 55(6): 888-896.
Steinstraesser L, et al. The human host defense peptide LL37/hCAP accelerates angiogenesis in PEGT/PBT biopolymers. Annals of plastic surgery. Jan 2006; 56(1): 93-98.
Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface.Invest. Ophthalmol. Vis. Sci. Jun 2006; 47(6): 2369-2380.
|
ll37 (Human)
