| Name
|
LL-37, Scrambled
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
|
| Sequence（Three letter abbreviations）
|
{Gly}{Leu}{Lys}{Leu}{Arg}{Phe}{Glu}{Phe}{Ser}{Lys}{Ile}{Lys}{Gly}{Glu}{Phe}{Leu}{Lys}{Thr}{Pro}{Glu}{Val}{Arg}{Phe}{Arg}{Asp}{Ile}{Lys}{Leu}{Lys}{Asp}{Asn}{Arg}{Ile}{Ser}{Val}{Gln}{Arg}
|
| Basic description
|
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version.
|
| The molecular weight
|
4493.300
|
| Chemical formula
|
C205H340N60O53
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Bandholtz L,Scand J Immunol. 2006 Jun;63(6):410-9.
|
LL-37, Scrambled
