| Name
|
Neuropeptide Y(1-36)
|
| Other Name
|
Neuropeptide Y(1-36)
|
| Sequence (Single letter abbreviations)
|
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
|
| Sequence（Three letter abbreviations）
|
{Tyr}{Pro}{Ser}{Lys}{Pro}{Asp}{Asn}{Pro}{Gly}{Glu}{Asp}{Ala}{Pro}{Ala}{Glu}{Asp}{Met}{Ala}{Arg}{Tyr}{Tyr}{Ser}{Ala}{Leu}{Arg}{His}{Tyr}{Ile}{Asn}{Leu}{Ile}{Thr}{Arg}{Gln}{Arg}{Tyr}
|
| Basic description
|
Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
|
| The molecular weight
|
4272.700
|
| Chemical formula
|
C189H284N54O58S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Wang F., et al. Reshaping Antibody Diversity. Cell. 2013 Jun;153(6):1379-93.
|
Neuropeptide Y(1-36)
