| Name
|
Parathyroid Hormone (PTH) (1-34), Human
|
| Other Name
|
PTH 1-34
|
| Sequence (Single letter abbreviations)
|
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
|
| Sequence（Three letter abbreviations）
|
{SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}{LEU}{GLY}{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU} {ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
|
| Solubility
|
Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water.
|
| The molecular weight
|
4117.740
|
| Chemical formula
|
C181H291N55O51S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Before using, store the peptide (PTH) in the DRY form at 4°C. For and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Iida-Klein A, et al. Effects of cyclic versus daily hPTH(1-34) regimens on bone strength in association with BMD, biochemical markers, and bone structure in mice. J Bone Miner Res. Feb 2006;21(2):274-282.
Hurley MM, et al. Impaired bone anabolic response to parathyroid hormone in Fgf2-/- and Fgf2+/- mice. Biochem Biophys Res Commun. Mar 24 2006;341(4):989-994.
Narayanan D., et al. In Vitro and In Vivo Evaluation of Osteoporosis Therapeutic Peptide PTH 1-34 Loaded PEGylated Chitosan Nanoparticles. Mol Pharm. 2013 Sep.
Narayanan D., et al. Synthesis, characterization and preliminary in vitro evaluation of PTH 1-34 loaded chitosan nanoparticles for osteoporosis. J Biomed Nanotechnol. 2012 Feb;8(1):98-106.
|
Parathyroid Hormone (PTH) (1-34), Human
