| Name
|
PACAP (1-27), Human, Ovine, Rat
|
| Other Name
|
HIV-1 TAT Protein Peptide; HIV1 TAT Protein PeptideHIV-1 TAT; HIV1 TAT
|
| Sequence (Single letter abbreviations)
|
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
|
| Sequence(Three letter abbreviations)
|
{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}-NH2
|
| C-port
|
NH2
|
| Basic description
|
PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo.
|
| The molecular weight
|
3147.620
|
| Chemical formula
|
C142H224N40O39S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
|