| Name
|
Secretoneurin, Rat
|
| Other Name
|
Secretogranin II
|
| Sequence (Single letter abbreviations)
|
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
|
| Sequence(Three letter abbreviations)
|
{THR}{ASN}{GLU}{ILE}{VAL}{GLU}{GLU}{GLN}{TYR}{THR}{PRO}{GLN}{SER}{LEU}{ALA}{THR}{LEU}{GLU}{SER}{VAL}{PHE}{GLN}{GLU}{LEU}{GLY}{LYS}{LEU}{THR}{GLY}{PRO}{SER}{ASN}{GLN}
|
| Basic description
|
Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
3651.950
|
| Chemical formula
|
C159H252N40O58
|
| The purity
|
> 95%
|
| Storage conditions
|
Storage at -20°C. Keep tightly closed.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Troger J, et al. Secretoneurin in the peripheral ocular innervation. Invest. Ophthalmol. Vis. Sci. Feb 2005; 46(2): 647-654.
Fischer-Colbrie R, et al. Secretoneurin: a new player in angiogenesis and chemotaxis linking nerves, blood vessels and the immune system. Curr. Protein Pept. Sci. Aug 2005; 6(4): 373-385.
|