| Name
|
TIP 39, Tuberoinfundibular Neuropeptide
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
|
| Sequence（Three letter abbreviations）
|
{Ser}{Leu}{Ala}{Leu}{Ala}{Asp}{Asp}{Ala}{Ala}{Phe}{Arg}{Glu}{Arg}{Ala}{Arg}{Leu}{Leu}{Ala}{Ala}{Leu}{Glu}{Arg}{Arg}{His}{Trp}{Leu}{Asn}{Ser}{Tyr}{Met}{His}{Lys}{Leu}{Leu}{Val}{Leu}{Asp}{Ala}{Pro}
|
| Basic description
|
This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
|
| The molecular weight
|
4504.200
|
| Chemical formula
|
C202H325N61O54S
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
TIP 39, Tuberoinfundibular Neuropeptide
