| Name
|
Urocortin III, Mouse
|
| Other Name
|
Ucn III; UcnIII; Ucn 3; Ucn3UrocortinIII; Urocortin 3; Urocortin3; LOC498791 Peptide
|
| Sequence (Single letter abbreviations)
|
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
|
| Sequence（Three letter abbreviations）
|
{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
|
| Solubility
|
Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
|
| The molecular weight
|
4172.970
|
| Chemical formula
|
C186H312N52O52S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Venkatasubramanian S., etc. Vascular Effects of Urocortins 2 and 3 in Healthy Volunteers. J Am Heart Assoc. 2013 Jan;2(1):e004267.
|
Urocortin III, Mouse
