| Name
|
VIP, Human, Ovine, Porcine, Rat
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
|
| Sequence（Three letter abbreviations）
|
{HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.
|
| Solubility
|
Soluble in water (1 mg/ml), colorless
|
| The molecular weight
|
3325.800
|
| Chemical formula
|
C147H238N44O42S
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
|
VIP, Human, Ovine, Porcine, Rat
