| Name
|
Β-Amyloid (1-42), Rat
|
| Other Name
|
Abeta 1-42, ratβ-Amyloid Peptide; βAmyloid Peptide; b-Amyloid Peptide; bAmyloid Peptide; beta-Amyloid Peptide; betaAmyloid Peptide
|
| Sequence (Single letter abbreviations)
|
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
|
| Sequence（Three letter abbreviations）
|
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}{ILE}{ALA}
|
| Basic description
|
Abeta 1-42 induces a strong membrane destabilization in giant unilamellar vesicles composed of palmitoyloleoyl-phosphatidylcholine, sphingomyelin, and cholesterol, lowering the critical tension of vesicle rupture. Additionally, Abeta 1-42 triggers the induction of sequential leakage of low- and -molecular-weight markers trapped inside the giant unilamellar vesicles, but preserving the vesicle shape. The Abeta 1-42 sequence confers particular molecular properties to the peptide that, in turn, influence supramolecular properties associated with membranes that may result in toxicity,including: 1) the ability of the peptide to strongly associate with the membrane; 2) a reduction of lateral membrane cohesive forces; and 3) a capacity to break the transbilayer gradient and puncture sealed vesicles.
|
| The molecular weight
|
4418.100
|
| Chemical formula
|
C199H307N53O59S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Folin M, et al. Apolipoprotein-E modulates the cytotoxic effect of beta-amyloid on rat brain endothelium in an isoform-dependent specific manner. Int J Mol Med. May 2006;17(5):821-826.
Chen L, et al. alpha7 Nicotinic acetylcholine receptor as a target to rescue deficit in hippocampal LTP induction in beta-amyloid infused rats. Neuropharmacology. Feb 2006;50(2):254-268.
Bastianetto S, et al. Neuroprotective effects of green and black teas and their catechin gallate esters against beta-amyloid-induced toxicity. Eur J Neurosci. Jan 2006;23(1):55-64.
|
Β-Amyloid (1-42), Rat
