| Name
|
Β-Amyloid (42-1)
|
| Other Name
|
βAmyloid; b-Amyloid; bAmyloid; beta-Amyloid; betaAmyloidβ-Amyloid
|
| Sequence (Single letter abbreviations)
|
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
|
| Sequence(Three letter abbreviations)
|
{ALA}{ILE}{VAL}{VAL}{GLY}{GLY}{VAL}{MET}{LEU}{GLY}{ILE}{ILE}{ALA}{GLY}{LYS}{ASN}{SER}{GLY}{VAL}{ASP}{GLU}{ALA}{PHE}{PHE}{VAL}{LEU}{LYS}{GLN}{HIS}{HIS}{VAL}{GLU}{TYR}{GLY}{SER}{ASP}{HIS}{ARG}{PHE}{GLU}{ALA}{ASP}
|
| Basic description
|
Beta amyloid (42-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer's disease (AD) brain.
|
| The molecular weight
|
4514.400
|
| Chemical formula
|
C203H311N55O60S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Anderson OA., etc. A2E Induces IL-1ß Production in Retinal Pigment Epithelial Cells via the NLRP3 Inflammasome. PLoS One. 2013 Jun;8(6):e67263.
|