| Name
|
Β-Endorphin, Equine
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
|
| Sequence(Three letter abbreviations)
|
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
|
| Basic description
|
Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
|
| The molecular weight
|
3423.950
|
| Chemical formula
|
C154H248N42O44S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
|