| Name
|
Agouti-related Protein (AGRP) (83-132) Amide (human)
|
| Code
|
|
| The alias
|
Agouti-related Protein (AGRP) (83-132) Amide (human)
|
| Sequence (single letter abbreviation)
|
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Cys5&Cys20 bridge , Cys12&Cys26 bridge , Cys19&Cys37 bridge , Cys23&Cys47 bridge , Cys28&Cys35 bridge)
|
| Sequence (three-letter abbreviation)
|
Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2(Cys5&Cys20 bridge , Cys12&Cys26 bridge , Cys19&Cys37 bridge , Cys23&Cys47 bridge , Cys28&Cys35 bridge)
|
| A basic description
|
Adrenomedullin-elicted cAMP antagonist and a more effective inhibitor than mCGRP in terms of adrenomedullin- and CGRP-specific receptors.
|
| solubility
|
|
| The molecular weight
|
3676.7
|
| Chemical formula
|
C235H362N76O67S11
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
(Cys5&Cys20 bridge , Cys12&Cys26 bridge , Cys19&Cys37 bridge , Cys23&Cys47 bridge , Cys28&Cys35 bridge)
|