| Name
|
Adrenomedullin (13-52), human
|
| Code
|
[154765-05-6]
|
| The alias
|
Adrenomedullin (13-52), human
|
| Sequence (single letter abbreviation)
|
SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2(C4&C9 bridge)
|
| Sequence (three-letter abbreviation)
|
H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2?(trifluoroacetate salt)(Cys4 and Cys9 bridge)
|
| A basic description
|
Adrenomedullin-elicted cAMP antagonist and a more effective inhibitor than alpha-CGRP in terms of adrenomedullin- and CGRP-specific receptors.
|
| solubility
|
|
| The molecular weight
|
4533.17
|
| Chemical formula
|
C200H308N58O59S2
|
| The purity
|
80%,90%,95%,98%,99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Heaton, J. O. H. N., et al. American Journal of Physiology-Heart and Circulatory Physiology 268.6 (1995): H2211-H2215.
Sone, Masahiko, et al. Peptides 18.8 (1997): 1125-1129.
Hyman, Albert L., et al. American Journal of Physiology-Heart and Circulatory Physiology 43.4 (1998): H1218.
Gumusel, Bulent, et al. American Journal of Physiology-Heart and Circulatory Physiology 274.4 (1998): H1255-H1263.
Chu, Duc Quyen, et al. British journal of pharmacology 130.7 (2000): 1589-1596.
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
(Cys4 and Cys9 bridge)
|