| Name
|
Amylin (8-37), rat
|
| Code
|
[135702-23-7]
|
| The alias
|
Amylin (8-37), rat
|
| Sequence (single letter abbreviation)
|
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
|
| Sequence (three-letter abbreviation)
|
H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2(trifluoroacetate salt)
|
| A basic description
|
37 amino acid polypeptide secreted from the beta cells of the pancreas and structurally related to calcitonin. It has anorectic effects in rats and may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. It blocks the activation of glycogen synthase by insulin.
|
| solubility
|
|
| The molecular weight
|
3200.6
|
| Chemical formula
|
C140H227N43O43
|
| The purity
|
80%,90%,95%,98%,99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
R.O. Deems et al., BBRC, 181, 116 (1991)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|