| Name
|
β-Amyloid (40-1)|beta-Amyloid (40-1)
|
| Code
|
[144409-99-4]
|
| The alias
|
β-Amyloid (40-1)|beta-Amyloid (40-1)
|
| Sequence (single letter abbreviation)
|
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
|
| Sequence (three-letter abbreviation)
|
H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH (trifluoroacetate salt)
|
| A basic description
|
Amyloid fragment shown to produce both the neurotoxic and the neurotrophic effects of beta-amyloid protein on cultured neurons. Furthermore, the peptide forms aggregates and typical amyloid fibrils resembling those of the beta-amyloid protein in senile plaque cores.
|
| solubility
|
|
| The molecular weight
|
4329.9
|
| Chemical formula
|
C194H295N53O58S1
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
N.W. Kowall et al., Proc. Nat. Acad. Sci. USA, 88, 7247 (1991)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|