| Name
|
(Arg6)-Amyloid beta-Protein (1-40)
|
| Code
|
|
| The alias
|
(Arg6)-Amyloid beta-Protein (1-40)
|
| Sequence (single letter abbreviation)
|
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
| Sequence (three-letter abbreviation)
|
H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt)
|
| A basic description
|
This peptide is the biologically active domain of the amyloid beta-protein for neurotrophic and neurotoxic effects, which is homologous to a region in peptides of the tachykinin family.
|
| solubility
|
|
| The molecular weight
|
4348.91
|
| Chemical formula
|
C194H300N54O58S1
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Y.Hori et al., J. Biol. Chem., 282, 4916 (2007)
K.Ono et al., J. Biol. Chem., 285, 23186 (2010)
B.Alies et al., Inorg. Chem., 50, 11192 (2011)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|