| Name
|
Defensin-1 (human)) HNP-1
|
| Code
|
[136661-76-2]
|
| The alias
|
Defensin-1 (human)) HNP-1
|
| Sequence (single letter abbreviation)
|
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridge, C4&C19 bridge, C 9&C29 bridge)
|
| Sequence (three-letter abbreviation)
|
H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt)(Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)
|
| A basic description
|
|
| solubility
|
|
| The molecular weight
|
3442.1
|
| Chemical formula
|
C150H222N44O38S6
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
T. Ganz et al., J. Clin. Invest., 76, 1427 (1985)
M.E. Selsted et al., J. Clin. Invest., 76, 1436 (1985)
T. Ganz et al., Eur. J. Haematol, 44, 1 (1990)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
(Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)
|