| Name
|
alpha-Defensin 6|Defensin HNP-3 (human)
|
| Code
|
[136661-76-2]
|
| The alias
|
alpha-Defensin 6|Defensin HNP-3 (human)
|
| Sequence (single letter abbreviation)
|
DCYCRIPACIAGERRYGTCIYQGRLWAFCC(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)
|
| Sequence (three-letter abbreviation)
|
H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt)(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)
|
| A basic description
|
A neuropeptide that when infused into the mesodiencephalic ventricle of recipient rabbits induces spindle and delta EEG activity and reduced motor activities
|
| solubility
|
|
| The molecular weight
|
3486.09
|
| Chemical formula
|
C151H222N44O40S6
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
P.A.Raj et al., Biochem. J., 347, 633 (2000)
F.T.Lundy et al., Oral Oncol., 40, 139 (2004)
Z.Wu et al., J. Pept. Res., 64, 118 (2004)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)
|