| Name
|
(Ser8)-GLP-1 (7-36),Glucagon-Like Peptide-1 (7-36) amide, human, bovine, guinea pig, mouse, rat
|
| Code
|
[215777-46-1]
|
| The alias
|
(Ser8)-GLP-1 (7-36),Glucagon-Like Peptide-1 (7-36) amide, human, bovine, guinea pig, mouse, rat
|
| Sequence (single letter abbreviation)
|
HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
|
| Sequence (three-letter abbreviation)
|
H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2(trifluoroacetate salt)
|
| A basic description
|
Oxyntomodulin is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion when infused iv. It was also proposed that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.
|
| solubility
|
|
| The molecular weight
|
3313.7
|
| Chemical formula
|
C149H226N40O46
|
| The purity
|
80%,90%,95%,98%,99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
U. Ritzel et al., J. Endocrinol., 159, 93 (1998)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|