| Name
|
VIP, Vasoactive Intestinal Peptide, guinea pig
|
| Code
|
[96886-24-7]
|
| The alias
|
VIP, Vasoactive Intestinal Peptide, guinea pig
|
| Sequence (single letter abbreviation)
|
HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2
|
| Sequence (three-letter abbreviation)
|
H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2(trifluoroacetate salt)
|
| A basic description
|
CD4 fragment that inhibits CD4 cell infection by HIV and HIV-induced cell fusion. As a cardioaccelerating peptide that has been derived from the corpus cardiacum of the American cockroach, Periplaneta Americana, corazonin is the most potent insect cardioactive neuropeptide.
|
| solubility
|
|
| The molecular weight
|
3344.9
|
| Chemical formula
|
C147H239N43O42S2
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
B.H. Du et al., BBRC, 128, 1093 (1985)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|