| Name
|
Copeptin (human)
|
| Code
|
[78362-34-2]
|
| The alias
|
Copeptin (human)
|
| Sequence (single letter abbreviation)
|
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
|
| Sequence (three-letter abbreviation)
|
H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH (trifluoroacetate salt)
|
| A basic description
|
Exendin (9-39) is a selective and potent against glucagon-like peptide 1 (GLP-1) and inhibits (Kd = 1.7 nm) cAMP production caused by Gastric Inhibitory Peptide (GIP). Exendin (9-39) is involved in appetite modulation by reducing insulin secretion and helps prevent sharp falls in glucose levels. This peptide has been studied for its? effects on the permeability of basal microvascular.
|
| solubility
|
|
| The molecular weight
|
4021.46
|
| Chemical formula
|
C177H279N49O58
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
J.Struck et al., Peptides, 26, 2500 (2005)
N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006)
S.Q.Khan et al., Circulation, 115, 2103 (2007)
G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007)
M.Katan et al., Crit. Care, 12, 117 (2008)
R.Seligman et al., Crit. Care, 12, R11 (2008)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|